H00009647-D01P

PPM1F antibody from Abnova Corporation
CAMKP, CaMKPase, FEM-2, KIAA0015, POPX2

Antibody data

Product number
H00009647-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009647-D01P, RRID:AB_1578994
Product name
PPM1F purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00009647-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human PPM1F protein.
Antigen sequence
MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLN
PEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRK
APPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEE
EEDDDEEEKAPVTLLDAQSLAQSFFNRLWEVAGQW
QKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVS
LPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAA
VHVHTNAARQPELPTDPEGALREAFRRTDQMFLRK
AKRERLQSGTTGVCALIAGATLHVAWLGDSQVILV
QQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDC
WRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTG
SEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGS
GLRVAEELVAAARERGSHDNITVMVVFLRDPQELL
EGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -