Antibody data

Product number
H00023532-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023532-D01, RRID:AB_10661199
Product name
PRAME MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00023532-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human PRAME protein.
Antigen sequence
MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLL
KDEALAIAALELLPRELFPPLFMAAFDGRHSQTLK
AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLD
VLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNR
ASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPV
EVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCC
KKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWK
LPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEK
EEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQ
LLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQ
LSVLSLSGVMLTDVSPEPLQALLERASATLQDLVF
DECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTL
HLERLAYLHARLRELLCELGRPSMVWLSANPCPHC
GDRTFYDPEPILCPCFMPN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -