Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00060485-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00060485-M02, RRID:AB_606988
- Product name
- SAV1 monoclonal antibody (M02), clone 3B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SAV1.
- Antigen sequence
HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDT
YQGMLKLLFMKELEQIVKMYEAYRQALLTELENRK
QRQQWYAQQHGKNF- Isotype
- IgG
- Antibody clone number
- 3B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mammalian ste20-like kinase and SAV1 promote 3T3-L1 adipocyte differentiation by activation of PPARγ.
Screening of binding proteins that interact with human Salvador 1 in a human fetal liver cDNA library by the yeast two-hybrid system.
LATS2 is a tumor suppressor gene of malignant mesothelioma.
Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction.
Park BH, Kim DS, Won GW, Jeon HJ, Oh BC, Lee Y, Kim EG, Lee YH
PloS one 2012;7(1):e30983
PloS one 2012;7(1):e30983
Screening of binding proteins that interact with human Salvador 1 in a human fetal liver cDNA library by the yeast two-hybrid system.
Li X, Luo X, Li Z, Wang G, Xiao H, Tao D, Gong J, Hu J
Molecular biology reports 2012 Aug;39(8):8225-30
Molecular biology reports 2012 Aug;39(8):8225-30
LATS2 is a tumor suppressor gene of malignant mesothelioma.
Murakami H, Mizuno T, Taniguchi T, Fujii M, Ishiguro F, Fukui T, Akatsuka S, Horio Y, Hida T, Kondo Y, Toyokuni S, Osada H, Sekido Y
Cancer research 2011 Feb 1;71(3):873-83
Cancer research 2011 Feb 1;71(3):873-83
Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction.
Mardin BR, Lange C, Baxter JE, Hardy T, Scholz SR, Fry AM, Schiebel E
Nature cell biology 2010 Dec;12(12):1166-76
Nature cell biology 2010 Dec;12(12):1166-76
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SAV1 monoclonal antibody (M02), clone 3B2. Western Blot analysis of SAV1 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SAV1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SAV1 on HeLa cell. [antibody concentration 60 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of SAV1 transfected lysate using anti-SAV1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SAV1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol