HPA026614

RUBCNL antibody from Sigma-Aldrich
C13orf18, FLJ21562, KIAA0226L, PACER
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026614
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026614, RRID:AB_10602693
Product name
Anti-C13orf18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026614
Antibody type
Polyclonal
Antigen
Uncharacterized protein C13orf18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVA
DMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQ
PDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSP
VTETRTYHDVKEICKCDVDEFVILELGDF
Storage
-20C
Provider Type Product Number
- No reagents -