Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406443 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GTP Binding Protein 4 (GTPBP4) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTPBP4 antibody: synthetic peptide directed towards the C terminal of human GTPBP4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPK
HLLSG KRKAGKKDRR- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification and characterization of putative tumor suppressor NGB, a GTP-binding protein that interacts with the neurofibromatosis 2 protein.
Lee H, Kim D, Dan HC, Wu EL, Gritsko TM, Cao C, Nicosia SV, Golemis EA, Liu W, Coppola D, Brem SS, Testa JR, Cheng JQ
Molecular and cellular biology 2007 Mar;27(6):2103-19
Molecular and cellular biology 2007 Mar;27(6):2103-19
No comments: Submit comment
No validations: Submit validation data