PAB22060

ADAM18 antibody from Abnova Corporation
ADAM27, tMDCIII

Antibody data

Product number
PAB22060
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22060, RRID:AB_10968521
Product name
ADAM18 polyclonal antibody
Provider product page
Abnova Corporation - PAB22060
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human ADAM18.
Reactivity
Human
Host
Rabbit
Antigen sequence
CQTTDNQCAKIFGKGAQGAPFACFKEVNSLHERSE
NCGFKNSQPLPCERKDVLCGKLACVQPHKNANKSD
AQS
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -