HPA027605

ADAM18 antibody from Sigma-Aldrich
ADAM27, tMDCIII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027605
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027605, RRID:AB_10600871
Product name
Anti-ADAM18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027605
Antibody type
Polyclonal
Antigen
ADAM metallopeptidase domain 18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CQTTDNQCAKIFGKGAQGAPFACFKEVNSLHERSE
NCGFKNSQPLPCERKDVLCGKLACVQPHKNANKSD
AQS
Storage
-20C
Provider Type Product Number
- No reagents -