Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005706-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005706-M02, RRID:AB_606862
- Product name
- PSMC6 monoclonal antibody (M02), clone 2C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PSMC6.
- Antigen sequence
LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHG
EIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADH
DFVVQEDFMKAVRKVADSKKLESKLDYKPV- Isotype
- IgG
- Antibody clone number
- 2C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PSMC6 expression in transfected 293T cell line by PSMC6 monoclonal antibody (M02), clone 2C4.Lane 1: PSMC6 transfected lysate(44.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PSMC6 monoclonal antibody (M02), clone 2C4. Western Blot analysis of PSMC6 expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PSMC6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol