Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00083852-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00083852-M07, RRID:AB_1112622
- Product name
- SETDB2 monoclonal antibody (M07), clone 1E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SETDB2.
- Antigen sequence
KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSC
CPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTEL
TWDYGYEAGTVPEKEIFCQCGVNKCRKKIL- Isotype
- IgG
- Antibody clone number
- 1E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SETDB2 monoclonal antibody (M07), clone 1E2. Western Blot analysis of SETDB2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SETDB2 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol