Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005740-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005740-A01, RRID:AB_606877
- Product name
- PTGIS polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PTGIS.
- Antigen sequence
PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGK
RLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLV
HLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVR
YRIRP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mechanism of prostacyclin-induced potentiation of glucose-induced insulin secretion.
Gurgul-Convey E, Hanzelka K, Lenzen S
Endocrinology 2012 Jun;153(6):2612-22
Endocrinology 2012 Jun;153(6):2612-22
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PTGIS polyclonal antibody (A01), Lot # 050921JC01 Western Blot analysis of PTGIS expression in NIH/3T3 ( Cat # L018V1 ).