Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502507 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PTGIS antibody: synthetic peptide directed towards the middle region of human PTGIS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNY
NMPWG AGHNHCLGRS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Characterization of the substrate mimic bound to engineered prostacyclin synthase in solution using high-resolution NMR spectroscopy and mutagenesis: implication of the molecular mechanism in biosynthesis of prostacyclin.
Ruan KH, Wu J, Cervantes V
Biochemistry 2008 Jan 15;47(2):680-8
Biochemistry 2008 Jan 15;47(2):680-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting