Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001159-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001159-M04, RRID:AB_1137139
- Product name
- CKMT1B monoclonal antibody (M04), clone 2C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CKMT1B.
- Antigen sequence
GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTA
ATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDC
ERRLERGQDIRIPTPVIHTKH- Isotype
- IgG
- Antibody clone number
- 2C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CKMT1B monoclonal antibody (M04), clone 2C8. Western Blot analysis of CKMT1B expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody (M04), clone 2C8.Lane 1: CKMT1B transfected lysate(47 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CKMT1B is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol