Antibody data

Product number
H00001159-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001159-M04, RRID:AB_1137139
Product name
CKMT1B monoclonal antibody (M04), clone 2C8
Provider product page
Abnova Corporation - H00001159-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CKMT1B.
Antigen sequence
GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTA
ATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDC
ERRLERGQDIRIPTPVIHTKH
Isotype
IgG
Antibody clone number
2C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -