HPA010634

TRAF2 antibody from Atlas Antibodies
RNF117, TRAP3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010634
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010634, RRID:AB_1080347
Product name
Anti-TRAF2
Provider product page
Atlas Antibodies - HPA010634
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASI
LSSGPQNCAACVHEGIYEEGISILESSSAFPDNAA
RREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPL
MLTECPACKGLVRLGEKERHLEHECPERSLSCRHC
RAPC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -