Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003949-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003949-M01, RRID:AB_606501
- Product name
- LDLR monoclonal antibody (M01), clone 5E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LDLR.
- Antigen sequence
PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSD
EASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCE
DGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL- Isotype
- IgG
- Antibody clone number
- 5E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The expression of LDL receptor in vessels with blood-brain barrier impairment in a stroke-prone hypertensive model.
Ueno M, Wu B, Nakagawa T, Nagai Y, Onodera M, Huang CL, Kusaka T, Kanenishi K, Sakamoto H
Histochemistry and cell biology 2010 Jun;133(6):669-76
Histochemistry and cell biology 2010 Jun;133(6):669-76
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LDLR expression in transfected 293T cell line by LDLR monoclonal antibody (M01), clone 5E7.Lane 1: LDLR transfected lysate(94.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LDLR is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol