Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023026 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023026, RRID:AB_10963931
- Product name
- Anti-WRAP53
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTA
WNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPD
GSCILTNSADNILRIYNLPPELYHEGEQVEYAEMV
PVLRMVEGDTIYDYC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Downregulation of the cancer susceptibility protein WRAP53β in epithelial ovarian cancer leads to defective DNA repair and poor clinical outcome
Hedström E, Pederiva C, Farnebo J, Nodin B, Jirström K, Brennan D, Farnebo M
Cell Death and Disease 2015 October;6(10)
Cell Death and Disease 2015 October;6(10)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and WRAP53 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY428451).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human fallopian tube and kidney tissues using Anti-WRAP53 antibody. Corresponding WRAP53 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube, kidney, liver and skin using Anti-WRAP53 antibody HPA023026 (A) shows similar protein distribution across tissues to independent antibody HPA028130 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-WRAP53 antibody HPA023026.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin using Anti-WRAP53 antibody HPA023026.
- Sample type
- HUMAN
