HPA028130

antibody from Atlas Antibodies

Targeting: WRAP53 FLJ10385, TCAB1, WDR79

Antibody data

Submit

Validation data

Product number: HPA028130 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA028130, RRID:AB_10961728
Product name: Anti-WRAP53
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVS LHPSLPLLATASGQRVFPEPTESGDEGEELGLPLL STRHVHLECRLQLWWCGGAPDSSIPD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

WRAP53 protein structure - HPA028130 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and kidney tissues using Anti-WRAP53 antibody. Corresponding WRAP53 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human fallopian tube, kidney, liver and skin using Anti-WRAP53 antibody HPA028130 (A) shows similar protein distribution across tissues to independent antibody HPA023026 (B).
Antibody #2 product nr: HPA023026
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-WRAP53 antibody HPA028130.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-WRAP53 antibody HPA028130.
Sample type: HUMAN