H00055829-D01

SELENOS antibody from Abnova Corporation
AD-015, MGC2553, SBBI8, SELS, SEPS1, VIMP

Antibody data

Product number
H00055829-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055829-D01, RRID:AB_10718958
Product name
SELS MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00055829-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human SELS protein.
Antigen sequence
MERQEESLSARPALETEGLRFLHTTVGSLLATYGW
YIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAV
EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLK
QLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDS
PGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACS
WRPGRRGPSSGG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -