HPA010025
antibody from Atlas Antibodies
Targeting: SELENOS
AD-015, MGC2553, SBBI8, SELS, SEPS1, VIMP
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010025 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010025, RRID:AB_1079900
- Product name
- Anti-SELENOS
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLK
QLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDS
PGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACS
WRPGR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Selective Up-regulation of Human Selenoproteins in Response to Oxidative Stress
Alternative transcripts and 3'UTR elements govern the incorporation of selenocysteine into selenoprotein S.
The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells.
Touat-Hamici Z, Legrain Y, Bulteau A, Chavatte L
Journal of Biological Chemistry 2014 May;289(21):14750-14761
Journal of Biological Chemistry 2014 May;289(21):14750-14761
Alternative transcripts and 3'UTR elements govern the incorporation of selenocysteine into selenoprotein S.
Bubenik JL, Miniard AC, Driscoll DM
PloS one 2013;8(4):e62102
PloS one 2013;8(4):e62102
The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells.
Paavilainen L, Edvinsson A, Asplund A, Hober S, Kampf C, Pontén F, Wester K
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2010 Mar;58(3):237-46
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2010 Mar;58(3):237-46
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SELENOS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN