HPA010025

SELENOS antibody from Atlas Antibodies
AD-015, MGC2553, SBBI8, SELS, SEPS1, VIMP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010025
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010025, RRID:AB_1079900
Product name
Anti-SELENOS
Provider product page
Atlas Antibodies - HPA010025
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLK
QLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDS
PGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACS
WRPGR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -