HPA010025

VIMP antibody from Atlas Antibodies
AD-015, MGC2553, SBBI8, SELS, SEPS1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010025
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010025, RRID:AB_888863
Product name
Anti-VIMP
Provider product page
Atlas Antibodies - HPA010025
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLK
QLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDS
PGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACS
WRPGR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -