Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008338 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008338, RRID:AB_10960401
- Product name
- Anti-HMGCR
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSN
CITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNL
LPQQACLQMLGVQGACKDNPGENARQLARIVCGTV
MAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Tumor-specific expression of HMG-CoA reductase in a population-based cohort of breast cancer patients.
HMG-CoA reductase expression in primary colorectal cancer correlates with favourable clinicopathological characteristics and an improved clinical outcome.
Targeting HMG-CoA reductase with statins in a window-of-opportunity breast cancer trial
Gustbée E, Tryggvadottir H, Markkula A, Simonsson M, Nodin B, Jirström K, Rose C, Ingvar C, Borgquist S, Jernström H
BMC clinical pathology 2015;15:8
BMC clinical pathology 2015;15:8
HMG-CoA reductase expression in primary colorectal cancer correlates with favourable clinicopathological characteristics and an improved clinical outcome.
Bengtsson E, Nerjovaj P, Wangefjord S, Nodin B, Eberhard J, Uhlén M, Borgquist S, Jirström K
Diagnostic pathology 2014 Apr 7;9:78
Diagnostic pathology 2014 Apr 7;9:78
Targeting HMG-CoA reductase with statins in a window-of-opportunity breast cancer trial
Bjarnadottir O, Romero Q, Bendahl P, Jirström K, Rydén L, Loman N, Uhlén M, Johannesson H, Rose C, Grabau D, Borgquist S
Breast Cancer Research and Treatment 2013 April;138(2):499-508
Breast Cancer Research and Treatment 2013 April;138(2):499-508
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gastrointestinal shows moderate granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN