Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012891 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012891, RRID:AB_1847617
- Product name
- Anti-DSC1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAV
LKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGK
TAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTV
RVCDCSTPSECRMKDKSTR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells.
Paavilainen L, Edvinsson A, Asplund A, Hober S, Kampf C, Pontén F, Wester K
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2010 Mar;58(3):237-46
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2010 Mar;58(3):237-46
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skin and prostate tissues using HPA012891 antibody. Corresponding DSC1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate to strong membranous positivity in epidermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows very weak membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows no membranous positivity in glandular cells.
- Sample type
- HUMAN