HPA026294

PRKCH antibody from MilliporeSigma / Merck KGaA
PKC-L, PKCL, PRKCL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026294
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026294, RRID:AB_10603988
Product name
Anti-PRKCH antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026294
Antibody type
Polyclonal
Antigen
protein kinase C, eta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDF
IKEEPVLTPIDEGHLPMINQDEFRNF
Storage
-20C
Provider Type Product Number
- No reagents -