HPA041690

antibody from Atlas Antibodies

Targeting: ABAT GABA-T, GABAT

Antibody data

Submit

Validation data

Product number: HPA041690 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041690, RRID:AB_10794674
Product name: Anti-ABAT
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DVEFDYDGPLMKTEVPGPRSQELMKQLNIIQNAEA VHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPI GYSHPALLKLIQQPQNASMFVNRPALGILPPENFV EKLRQS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ABAT protein structure - HPA041690 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and endometrium tissues using Anti-ABAT antibody. Corresponding ABAT RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, endometrium, kidney and liver using Anti-ABAT antibody HPA041690 (A) shows similar protein distribution across tissues to independent antibody HPA041528 (B).
Antibody #2 product nr: HPA041528
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ABAT antibody HPA041690.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ABAT antibody HPA041690.
Sample type: HUMAN