HPA030339

RCHY1 antibody from MilliporeSigma / Merck KGaA
ARNIP, CHIMP, DKFZp586C1620, PIRH2, PRO1996, RNF199, ZCHY, ZNF363
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030339
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030339, RRID:AB_10603232
Product name
Anti-RCHY1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030339
Antibody type
Polyclonal
Antigen
ring finger and CHY zinc finger domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLK
CNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSR
VVAHVLPCGHL
Storage
-20C
Provider Type Product Number
- No reagents -