Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057575-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057575-M07, RRID:AB_1137349
- Product name
- PCDH10 monoclonal antibody (M07), clone 2H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCDH10.
- Antigen sequence
SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARG
FQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQ
SPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSF
PEPDL- Isotype
- IgG
- Antibody clone number
- 2H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PCDH10 monoclonal antibody (M07), clone 2H6. Western Blot analysis of PCDH10 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PCDH10 expression in transfected 293T cell line by PCDH10 monoclonal antibody (M07), clone 2H6.Lane 1: PCDH10 transfected lysate(112.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PCDH10 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol