HPA011220

PCDH10 antibody from Sigma-Aldrich
KIAA1400, OL-PCDH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011220
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011220, RRID:AB_1855041
Product name
Anti-PCDH10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011220
Antibody type
Polyclonal
Antigen
Protocadherin-10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEKKLNIYTCLASDCCLCCCCCGGGGSTCCGRQAR
ARKKKLSKSDIMLVQSSNVPSNPAQVPIEESGGFG
SHHHNQNYCYQVCLTPESAKTDLMFLKPCSPSRST
DTEHNPCGAIVTGYTDQQPDIISNGSILSNETKHQ
RA
Storage
-20C
Provider Type Product Number
- No reagents -