HPA027901

EEF1E1 antibody from Sigma-Aldrich
AIMP3, P18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027901
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027901, RRID:AB_10611960
Product name
Anti-EEF1E1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027901
Antibody type
Polyclonal
Antigen
eukaryotic translation elongation factor 1 epsilon 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSL
TGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLE
YRVTQVDGHSSKNDIHTLLKDL
Storage
-20C
Provider Type Product Number
- No reagents -