Antibody data
- Product number
- HPA012911
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012911, RRID:AB_1845173
- Product name
- Anti-ATP1B1
- Provider product page
- Atlas Antibodies - HPA012911
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPK
SYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPS
EPKERGDFNHERGERKVCRFKLEWLGNCSGLNDET
YGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPV
MKYNPN
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and aTP1B1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400361).
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more