Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012911 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012911, RRID:AB_1845173
- Product name
- Anti-ATP1B1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPK
SYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPS
EPKERGDFNHERGERKVCRFKLEWLGNCSGLNDET
YGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPV
MKYNPN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Na,K-ATPase β1-subunit is a target of sonic hedgehog signaling and enhances medulloblastoma tumorigenicity.
Lee SJ, Litan A, Li Z, Graves B, Lindsey S, Barwe SP, Langhans SA
Molecular cancer 2015 Aug 19;14:159
Molecular cancer 2015 Aug 19;14:159
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows low expression as expected.
- Sample type
- HUMAN