Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- NBP1-93706 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#NBP1-93706, RRID:AB_11017966
- Product name
- Rabbit Polyclonal PLA2G10 Antibody
- Antibody type
- Polyclonal
- Antigen
- This antibody was developed against Recombinant Protein corresponding to amino acids:ASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCH
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 0.1 ml
- Storage
- Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Western Blot: PLA2G10 Antibody [NBP1-93706] - Analysis in control (vector only transfected HEK293T lysate) and PLA2G10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunohistochemistry-Paraffin: PLA2G10 Antibody [NBP1-93706] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
