HPA011633

ADAM15 antibody from Sigma-Aldrich
MDC15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011633
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011633, RRID:AB_1844574
Product name
Anti-ADAM15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011633
Antibody type
Polyclonal
Antigen
ADAM 15 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPS
GSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLW
ETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTAC
GPGLVCIDHRCQRVDLLGAQECRSKC
Storage
-20C
Provider Type Product Number
- No reagents -