Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055589-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055589-M03, RRID:AB_10755632
- Product name
- BMP2K monoclonal antibody (M03), clone X1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BMP2K.
- Antigen sequence
YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPA
LVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANF
TNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDRE
FDLLRS- Isotype
- IgG
- Antibody clone number
- X1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BMP2K expression in transfected 293T cell line by BMP2K monoclonal antibody (M03), clone X1.Lane 1: BMP2K transfected lysate(73.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BMP2K is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to BMP2K on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
