HPA026436

BMP2K antibody from Sigma-Aldrich
BIKe, DKFZp434K0614
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026436, RRID:AB_10600102
Product name
Anti-BMP2K antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026436
Antibody type
Polyclonal
Antigen
BMP2 inducible kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FISHSGSPEKKAEHSSINQENGTANPIKNGKTSPA
SKDQRTGKKTSVQGQVQKGNDESESDFESDPPSPK
SSEEEEQDDEEV
Storage
-20C
Provider Type Product Number
- No reagents -