HPA026501

BMP2K antibody from MilliporeSigma / Merck KGaA
BIKe, DKFZp434K0614
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026501
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026501, RRID:AB_10601341
Product name
Anti-BMP2K antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026501
Antibody type
Polyclonal
Antigen
BMP2 inducible kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSANRSVADKEAIANFTNQKNISNPPDMSGWNPFG
EDNFSKLTEEELLDREFDLLRSNRLEERASSDKNV
DSLSAPHNH
Storage
-20C
Provider Type Product Number
- No reagents -