HPA012710

PTPRF antibody from Sigma-Aldrich
LAR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012710
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012710, RRID:AB_1855933
Product name
Anti-PTPRF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012710
Antibody type
Polyclonal
Antigen
Receptor-type tyrosine-protein phosphatase F precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WHPPKELPGELLGYRLQYCRADEARPNTIDFGKDD
QHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIR
TPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAER
NGRIISYTVVFRDINSQQE
Storage
-20C
Provider Type Product Number
- No reagents -