Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28312 - Provider product page

- Provider
- Abnova Corporation
- Product name
- BMP3 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of recombinant BMP3.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LSATLYFCIGELGNISLSCPVSGGCSHHAQRKHIQ
IDLSAWTLKFSRNQSQLLGHLSVDMAKSHRDIMSW
LS- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4 Lane 2: U-251 MG Lane 3: Human Plasma Lane 4: Liver Lane 5: Tonsil with BMP3 polyclonal antibody ( Cat # PAB28312) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis with BMP3 polyclonal antibody ( Cat # PAB28312 ) shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells at 1:20 - 1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)