HPA013839

LRTM1 antibody from Sigma-Aldrich
HT017
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013839
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013839, RRID:AB_2138200
Product name
Anti-LRTM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013839
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and transmembrane domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSLGETWENLTILAVQQNQLQQLDRALLESMPSVR
LLLLKDNLWKCNCHLLGLKLWLEKFVYKGGLTDGI
ICESPDTWKGKDLLRIPHELYQPCPLPAPDPVSSQ
AQWPGSAHGVVLRPPENHNAGERELLECELKPKPR
PANLRHAI
Storage
-20C
Provider Type Product Number
- No reagents -