HPA012164

CDH22 antibody from Sigma-Aldrich
C20orf25, dJ998H6.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012164
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012164, RRID:AB_1845902
Product name
Anti-CDH22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012164
Antibody type
Polyclonal
Antigen
Cadherin-22 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYH
LKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFES
QPVHTVILEALNKFVDPRFADLGTFRDQAIVRVAV
TDVDEP
Storage
-20C
Provider Type Product Number
- No reagents -