Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051733-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051733-M09, RRID:AB_1581730
- Product name
- UPB1 monoclonal antibody (M09), clone 3F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UPB1.
- Antigen sequence
AINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYV
AAPDSSRTPGLSRSRDGLLVAKLDLNLCQQVNDVW
NFKMTGRYEMYARELAEAVKSNYSPTIVKE- Isotype
- IgG
- Antibody clone number
- 3F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UPB1 monoclonal antibody (M09), clone 3F12. Western Blot analysis of UPB1 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UPB1 monoclonal antibody (M09), clone 3F12. Western Blot analysis of UPB1 expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UPB1 expression in transfected 293T cell line by UPB1 monoclonal antibody (M09), clone 3F12.Lane 1: UPB1 transfected lysate (Predicted MW: 43.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UPB1 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to UPB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol