Antibody data
- Product number
- HPA000728
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000728, RRID:AB_1080471
- Product name
- Anti-UPB1
- Provider product page
- Atlas Antibodies - HPA000728
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GALSESLWPIEARNAAIANHCFTCAINRVGTEHFP
NEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGL
SRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEMY
ARELAEAVKSNYS
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image

- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and UPB1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414060).
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon shows low expression as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human liver and colon tissues using Anti-UPB1 antibody. Corresponding UPB1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more