Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310344 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ureidopropionase, beta (UPB1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UPB1 antibody: synthetic peptide directed towards the middle region of human UPB1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGN
LGHPV FQTQFGRIAV- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references beta-Ureidopropionase deficiency: an inborn error of pyrimidine degradation associated with neurological abnormalities.
van Kuilenburg AB, Meinsma R, Beke E, Assmann B, Ribes A, Lorente I, Busch R, Mayatepek E, Abeling NG, van Cruchten A, Stroomer AE, van Lenthe H, Zoetekouw L, Kulik W, Hoffmann GF, Voit T, Wevers RA, Rutsch F, van Gennip AH
Human molecular genetics 2004 Nov 15;13(22):2793-801
Human molecular genetics 2004 Nov 15;13(22):2793-801
No comments: Submit comment
No validations: Submit validation data