HPA000728

UPB1 antibody from Sigma-Aldrich
BUP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000728
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000728, RRID:AB_1080471
Product name
Anti-UPB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000728
Antibody type
Polyclonal
Antigen
beta-Ureidopropionase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GALSESLWPIEARNAAIANHCFTCAINRVGTEHFP
NEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGL
SRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEMY
ARELAEAVKSNYS
Storage
-20C
Provider Type Product Number
- No reagents -