Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051738-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051738-M01, RRID:AB_565766
- Product name
- GHRL monoclonal antibody (M01), clone 2F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GHRL.
- Antigen sequence
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRV
QQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAED
EMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDI
LWEEAKEAPADK- Isotype
- IgG
- Antibody clone number
- 2F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mapping of ghrelin gene expression and cell distribution in the stomach of morbidly obese patients--a possible guide for efficient sleeve gastrectomy construction.
Goitein D, Lederfein D, Tzioni R, Berkenstadt H, Venturero M, Rubin M
Obesity surgery 2012 Apr;22(4):617-22
Obesity surgery 2012 Apr;22(4):617-22
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GHRL monoclonal antibody (M01), clone 2F4. Western Blot analysis of GHRL expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GHRL is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GHRL on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol