HPA010738

ADAM17 antibody from Sigma-Aldrich
CD156B, cSVP, TACE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010738
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010738, RRID:AB_1078100
Product name
Anti-ADAM17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010738
Antibody type
Polyclonal
Antigen
ADAM 17 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIR
INTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKN
VSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELV
HRVKRRADPDPMKNTCKLLVVADHRFYR
Storage
-20C
Provider Type Product Number
- No reagents -