H00009771-M09

RAPGEF5 antibody from Abnova Corporation
GFR, KIAA0277, MR-GEF

Antibody data

Product number
H00009771-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009771-M09, RRID:AB_1579565
Product name
RAPGEF5 monoclonal antibody (M09), clone 2E4
Provider product page
Abnova Corporation - H00009771-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RAPGEF5.
Antigen sequence
MGSSRLRVFDPHLERKDSAAALSDRELPLPTFDVP
YFKYIDEEDEDDEWSSRSQSSTEDDSVDSLLSDRY
VVVSGTPEKILEHLLNDLHLEEVQDKETETLLDDF
LLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDV
PRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTI
YRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDE
YSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFC
HVYITEHSYVSVKAKVSSIAQEILLCSQLGKRVQL
VKKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSRL
SQTWEKIPGKFRKLFSELESLTDPSLNHKAYRDAF
KKMKPPKIPFVPLLLKDVTFIHEGNKTFLDNLVNF
EKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSY
VNHLYVIDSQQALFELSHRIEPRV
Isotype
IgG
Antibody clone number
2E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -