HPA001100

CRKL antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001100
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001100, RRID:AB_1078569
Product name
Anti-CRKL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001100
Antibody type
Polyclonal
Antigen
Crk-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQ
WWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRN
SNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITP
LPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIV
KVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNP
DE
Storage
-20C
Provider Type Product Number
- No reagents -