H00004968-B01P

OGG1 antibody from Abnova Corporation
HMMH, HOGG1, MUTM, OGH1

Antibody data

Product number
H00004968-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004968-B01P, RRID:AB_1578269
Product name
OGG1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00004968-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human OGG1 protein.
Antigen sequence
MPARALLPRRMGHRTLASTPALWASIPCPRSELRL
DLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE
EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVT
LAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC
LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDD
VTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA
SARAILEEQGGLAWLQQLRESSYEEAHKALCILPG
VGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS
WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQ
AVSVPRCPP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -