HPA027514

OGG1 antibody from Sigma-Aldrich
HMMH, HOGG1, MUTM, OGH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027514
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027514, RRID:AB_10602189
Product name
Anti-OGG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027514
Antibody type
Polyclonal
Antigen
8-oxoguanine DNA glycosylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDP
IECLFSFICSSNNNIARITGMVERLCQAFGPRLIQ
L
Storage
-20C
Provider Type Product Number
- No reagents -