Antibody data

Product number
H00006443-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006443-M01, RRID:AB_519041
Product name
SGCB monoclonal antibody (M01), clone 1E3
Provider product page
Abnova Corporation - H00006443-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant SGCB.
Antigen sequence
MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKE
HNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVII
LLFILAVINLIITLVIWAVIRIGPNGCDSMEFHES
GLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN
NQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRT
QNILFSTDYETHEFHLPSGVKSLNVQKASTERITS
NATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGG
NMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSG
DWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCG
NTH
Isotype
IgG
Antibody clone number
1E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -