HPA011422

SGCB antibody from Sigma-Aldrich
A3b, LGMD2E, SGC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011422
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011422, RRID:AB_1856795
Product name
Anti-SGCB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011422
Antibody type
Polyclonal
Antigen
Beta-sarcoglycan recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGD
QLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQIS
DNPCGNTH
Storage
-20C
Provider Type Product Number
- No reagents -