SAB1400259

SGCB antibody from Sigma-Aldrich
A3b, LGMD2E, SGC
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
SAB1400259
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400259, RRID:AB_1843573
Product name
Monoclonal Anti-SGCB antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400259
Antibody type
Monoclonal
Antigen
SGCB (NP_000223, a.a. 87-197) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
WAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHP
LYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVE
NNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHL
PSGVK* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -